NDUFS4 (NM_002495) Human Mass Spec Standard
CAT#: PH302713
NDUFS4 MS Standard C13 and N15-labeled recombinant protein (NP_002486)
View other "NDUFS4" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NDUFS4 MS Standard C13 and N15-labeled recombinant protein (NP_002486) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202713 |
Predicted MW | 20.1 kDa |
Protein Sequence |
>RC202713 protein sequence
Red=Cloning site Green=Tags(s) MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEE HIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEK NGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002486 |
RefSeq Size | 676 |
RefSeq ORF | 525 |
Synonyms | AQDQ; CI-18; CI-18 kDa; CI-AQDQ; MC1DN1 |
Locus ID | 4724 |
Cytogenetics | 5q11.2 |
Summary | This gene encodes an nuclear-encoded accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (complex I, or NADH:ubiquinone oxidoreductase). Complex I removes electrons from NADH and passes them to the electron acceptor ubiquinone. Mutations in this gene can cause mitochondrial complex I deficiencies such as Leigh syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419295 | NDUFS4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419295 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) (NDUFS4), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP302713 | Recombinant protein of human NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) (NDUFS4), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |