CXCL5 (NM_002994) Human Mass Spec Standard
CAT#: PH302707
CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985)
View other "CXCL5" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CXCL5 MS Standard C13 and N15-labeled recombinant protein (NP_002985) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202707 |
Predicted MW | 12 kDa |
Protein Sequence |
>RC202707 protein sequence
Red=Cloning site Green=Tags(s) MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002985 |
RefSeq Size | 2505 |
RefSeq ORF | 342 |
Synonyms | ENA-78; SCYB5 |
Locus ID | 6374 |
Cytogenetics | 4q13.3 |
Summary | This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils, to promote angiogenesis and to remodel connective tissues. This protein is thought to play a role in cancer cell proliferation, migration, and invasion. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401049 | CXCL5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401049 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 5 (CXCL5) |
CNY 3,080.00 |
|
TP302707 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), 20 µg |
CNY 2,900.00 |
|
TP700192 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K mutant, 20 ug |
CNY 6,650.00 |
|
TP700193 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R48K mutant, 20 ug |
CNY 6,650.00 |
|
TP700194 | Recombinant protein of human chemokine (C-X-C motif) ligand 5 (CXCL5), R45K and R48K double mutant, 20 ug |
CNY 6,650.00 |
|
TP720876 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 5 (CXCL5) |
CNY 1,800.00 |