Caveolin 2 (CAV2) (NM_001233) Human Mass Spec Standard
CAT#: PH302703
CAV2 MS Standard C13 and N15-labeled recombinant protein (NP_001224)
View other "Caveolin 2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CAV2 MS Standard C13 and N15-labeled recombinant protein (NP_001224) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202703 |
Predicted MW | 18.1 kDa |
Protein Sequence |
>RC202703 representing NM_001233
Red=Cloning site Green=Tags(s) MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVW ICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVI IAPLCTSVGRCFSSVSLQLSQD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001224 |
RefSeq Size | 3332 |
RefSeq ORF | 486 |
Synonyms | CAV |
Locus ID | 858 |
Cytogenetics | 7q31.2 |
Summary | The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462). [provided by RefSeq, May 2011] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Focal adhesion |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403682 | CAV2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420057 | CAV2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403682 | Transient overexpression lysate of caveolin 2 (CAV2), transcript variant 2 |
CNY 3,080.00 |
|
LY420057 | Transient overexpression lysate of caveolin 2 (CAV2), transcript variant 1 |
CNY 3,080.00 |
|
TP302703 | Recombinant protein of human caveolin 2 (CAV2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP760372 | Purified recombinant protein of Human caveolin 2 (CAV2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
TP761854 | Purified recombinant protein of Human caveolin 2 (CAV2), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Caveolin 2产品