CRSP9 (MED7) (NM_004270) Human Mass Spec Standard
CAT#: PH302696
MED7 MS Standard C13 and N15-labeled recombinant protein (NP_004261)
View other "CRSP9" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MED7 MS Standard C13 and N15-labeled recombinant protein (NP_004261) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202696 |
Predicted MW | 27.1 kDa |
Protein Sequence |
>RC202696 representing NM_004270
Red=Cloning site Green=Tags(s) MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPM QFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMME VQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGH RRDQIIEKDAALCVLIDEMNERP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004261 |
RefSeq Size | 1066 |
RefSeq ORF | 699 |
Synonyms | ARC34; CRSP9; CRSP33 |
Locus ID | 9443 |
Cytogenetics | 5q33.3 |
Summary | The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418057 | MED7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420292 | MED7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418057 | Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 2 |
CNY 3,080.00 |
|
LY420292 | Transient overexpression lysate of mediator complex subunit 7 (MED7), transcript variant 1 |
CNY 3,080.00 |
|
TP302696 | Recombinant protein of human mediator complex subunit 7 (MED7), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP761746 | Purified recombinant protein of Human mediator complex subunit 7 (MED7), transcript variant 1, full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |