Apc10 (ANAPC10) (NM_014885) Human Mass Spec Standard
CAT#: PH302679
ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700)
View other "Apc10" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202679 |
Predicted MW | 21.3 kDa |
Protein Sequence |
>RC202679 protein sequence
Red=Cloning site Green=Tags(s) MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055700 |
RefSeq Size | 1457 |
RefSeq ORF | 555 |
Synonyms | APC10; DOC1 |
Locus ID | 10393 |
Cytogenetics | 4q31.21 |
Summary | ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414956 | ANAPC10 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY414956 | Transient overexpression lysate of anaphase promoting complex subunit 10 (ANAPC10) |
CN¥ 3,080.00 |
|
TP302679 | Recombinant protein of human anaphase promoting complex subunit 10 (ANAPC10), 20 µg |
CN¥ 2,900.00 |