EIF4A3 (NM_014740) Human Mass Spec Standard
CAT#: PH302567
EIF4A3 MS Standard C13 and N15-labeled recombinant protein (NP_055555)
View other "EIF4A3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EIF4A3 MS Standard C13 and N15-labeled recombinant protein (NP_055555) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202567 |
Predicted MW | 46.9 kDa |
Protein Sequence |
>RC202567 protein sequence
Red=Cloning site Green=Tags(s) MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIK QIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHAC IGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPP ATQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQA VIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLII NYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055555 |
RefSeq Size | 1734 |
RefSeq ORF | 1233 |
Synonyms | DDX48; eIF-4A-III; eIF4A-III; eIF4AIII; Fal1; MUK34; NMP265; NUK34; RCPS |
Locus ID | 9775 |
Cytogenetics | 17q25.3 |
Summary | This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a nuclear matrix protein. Its amino acid sequence is highly similar to the amino acid sequences of the translation initiation factors eIF4AI and eIF4AII, two other members of the DEAD box protein family. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402368 | EIF4A3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402368 | Transient overexpression lysate of eukaryotic translation initiation factor 4A, isoform 3 (EIF4A3) |
CNY 3,080.00 |
|
TP302567 | Recombinant protein of human eukaryotic translation initiation factor 4A, isoform 3 (EIF4A3), 20 µg |
CNY 2,900.00 |