TTC11 (FIS1) (NM_016068) Human Mass Spec Standard
CAT#: PH302560
FIS1 MS Standard C13 and N15-labeled recombinant protein (NP_057152)
View other "TTC11" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FIS1 MS Standard C13 and N15-labeled recombinant protein (NP_057152) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202560 |
Predicted MW | 16.9 kDa |
Protein Sequence |
>RC202560 protein sequence
Red=Cloning site Green=Tags(s) MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA GLIGLAVSKSKS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057152 |
RefSeq Size | 785 |
RefSeq ORF | 456 |
Synonyms | CGI-135; TTC11 |
Locus ID | 51024 |
Cytogenetics | 7q22.1 |
Summary | The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402496 | FIS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402496 | Transient overexpression lysate of fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP302560 | Recombinant protein of human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
|
TP720888 | Purified recombinant protein of Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein |
CNY 3,140.00 |