PIN1 (NM_006221) Human Mass Spec Standard
CAT#: PH302543
PIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006212)
View other "PIN1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PIN1 MS Standard C13 and N15-labeled recombinant protein (NP_006212) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202543 |
Predicted MW | 18.2 kDa |
Protein Sequence |
>RC202543 protein sequence
Red=Cloning site Green=Tags(s) MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA LRTGEMSGPVFTDSGIHIILRTE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006212 |
RefSeq Size | 1138 |
RefSeq ORF | 489 |
Synonyms | DOD; UBL5 |
Locus ID | 5300 |
Cytogenetics | 19p13.2 |
Summary | Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401873 | PIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401873 | Transient overexpression lysate of peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1) |
CNY 3,080.00 |
|
TP302543 | Recombinant protein of human peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (PIN1), 20 µg |
CNY 2,900.00 |