Guanylate kinase (GUK1) (NM_000858) Human Mass Spec Standard
CAT#: PH302510
GUK1 MS Standard C13 and N15-labeled recombinant protein (NP_000849)
View other "Guanylate kinase" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | GUK1 MS Standard C13 and N15-labeled recombinant protein (NP_000849) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202510 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC202510 protein sequence
Red=Cloning site Green=Tags(s) MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDF IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTE TEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000849 |
RefSeq Size | 1155 |
RefSeq ORF | 591 |
Synonyms | GMK |
Locus ID | 2987 |
Cytogenetics | 1q42.13 |
Summary | The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400303 | GUK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431782 | GUK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400303 | Transient overexpression lysate of guanylate kinase 1 (GUK1), transcript variant 2 |
CNY 3,080.00 |
|
LY431782 | Transient overexpression lysate of guanylate kinase 1 (GUK1), transcript variant 3 |
CNY 3,080.00 |
|
TP302510 | Recombinant protein of human guanylate kinase 1 (GUK1), 20 µg |
CNY 2,900.00 |
其它Guanylate kinase产品