VPS25 (NM_032353) Human Mass Spec Standard
CAT#: PH302487
VPS25 MS Standard C13 and N15-labeled recombinant protein (NP_115729)
View other "VPS25" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | VPS25 MS Standard C13 and N15-labeled recombinant protein (NP_115729) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202487 |
Predicted MW | 20.7 kDa |
Protein Sequence |
>RC202487 protein sequence
Red=Cloning site Green=Tags(s) MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLP VESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEE FHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_115729 |
RefSeq Size | 1120 |
RefSeq ORF | 528 |
Synonyms | DERP9; EAP20; FAP20 |
Locus ID | 84313 |
Cytogenetics | 17q21.2 |
Summary | This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on chromosome 1. [provided by RefSeq, Jul 2013] |
Protein Families | Transcription Factors |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410190 | VPS25 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY410190 | Transient overexpression lysate of vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25) |
CN¥ 3,080.00 |
|
TP302487 | Recombinant protein of human vacuolar protein sorting 25 homolog (S. cerevisiae) (VPS25), 20 µg |
CN¥ 2,900.00 |