CSNK2A2 (NM_001896) Human Mass Spec Standard
CAT#: PH302435
CSNK2A2 MS Standard C13 and N15-labeled recombinant protein (NP_001887)
View other "CSNK2A2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CSNK2A2 MS Standard C13 and N15-labeled recombinant protein (NP_001887) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202435 |
Predicted MW | 41.2 kDa |
Protein Sequence |
>RC202435 protein sequence
Red=Cloning site Green=Tags(s) MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKI LKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYE LLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMY DYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRK RWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001887 |
RefSeq Size | 1674 |
RefSeq ORF | 1050 |
Synonyms | CK2A2; CK2alpha'; CSNK2A1 |
Locus ID | 1459 |
Cytogenetics | 16q21 |
Summary | This gene encodes the alpha', or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythms. This heterotetrameric kinase includes two catalytic subunits, either alpha or alpha', and two regulatory beta subunits. The closely related gene paralog encoding the alpha, or alpha 1 subunit (CSNK2A1, Gene ID: 1457) is found on chromosome 20. An intronic variant in this gene (alpha 2) may be associated with leukocyte telomere length in a South Asian population. A related transcribed pseudogene is found on chromosome 11. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Adherens junction, Tight junction, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400706 | CSNK2A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400706 | Transient overexpression lysate of casein kinase 2, alpha prime polypeptide (CSNK2A2) |
CNY 3,080.00 |
|
TP302435 | Recombinant protein of human casein kinase 2, alpha prime polypeptide (CSNK2A2), 20 µg |
CNY 2,900.00 |
其它CSNK2A2产品