LSM6 (NM_007080) Human Mass Spec Standard
CAT#: PH302373
LSM6 MS Standard C13 and N15-labeled recombinant protein (NP_009011)
View other "LSM6" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | LSM6 MS Standard C13 and N15-labeled recombinant protein (NP_009011) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202373 |
Predicted MW | 9.1 kDa |
Protein Sequence |
>RC202373 protein sequence
Red=Cloning site Green=Tags(s) MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV LYISTQKRRM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_009011 |
RefSeq Size | 789 |
RefSeq ORF | 240 |
Synonyms | YDR378C |
Locus ID | 11157 |
Cytogenetics | 4q31.22 |
Summary | Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM, Apr 2004] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation, Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416217 | LSM6 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416217 | Transient overexpression lysate of LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6) |
CN¥ 3,080.00 |
|
TP302373 | Recombinant protein of human LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM6), 20 µg |
CN¥ 2,900.00 |