CPVL (NM_031311) Human Mass Spec Standard
CAT#: PH302336
CPVL MS Standard C13 and N15-labeled recombinant protein (NP_112601)
View other "CPVL" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CPVL MS Standard C13 and N15-labeled recombinant protein (NP_112601) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202336 |
Predicted MW | 54.2 kDa |
Protein Sequence |
>RC202336 protein sequence
Red=Cloning site Green=Tags(s) MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGRELSLVGPFPGLN MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGLFVEHGPYVVTSNMTLRDRDF PWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYV PAIAHLIHSLNPVREVKINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK QNWFEAFEILDKLLDGDLTSDPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFN DGTIVEKYLREDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK IFKSDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_112601 |
RefSeq Size | 1691 |
RefSeq ORF | 1428 |
Synonyms | HVLP |
Locus ID | 54504 |
Cytogenetics | 7p14.3 |
Summary | The protein encoded by this gene is a carboxypeptidase and bears strong sequence similarity to serine carboxypeptidases. Carboxypeptidases are a large class of proteases that act to cleave a single amino acid from the carboxy termini of proteins or peptides. The exact function of this protein, however, has not been determined. [provided by RefSeq, Jan 2017] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410561 | CPVL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412799 | CPVL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410561 | Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 |
CNY 3,080.00 |
|
LY412799 | Transient overexpression lysate of carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2 |
CNY 3,080.00 |
|
PH320622 | CPVL MS Standard C13 and N15-labeled recombinant protein (NP_061902) |
CNY 19,520.00 |
|
TP302336 | Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP320622 | Recombinant protein of human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP721099 | Purified recombinant protein of Human carboxypeptidase, vitellogenic-like (CPVL), transcript variant 1 |
CNY 3,140.00 |