Membrin (GOSR2) (NM_004287) Human Mass Spec Standard
CAT#: PH302175
GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278)
View other "Membrin" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202175 |
Predicted MW | 24.8 kDa |
Protein Sequence |
>RC202175 protein sequence
Red=Cloning site Green=Tags(s) MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY LT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004278 |
RefSeq Size | 3319 |
RefSeq ORF | 636 |
Synonyms | Bos1; EPM6; GS27 |
Locus ID | 9570 |
Cytogenetics | 17q21.32 |
Summary | This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409306 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418077 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422877 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409306 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant B |
CNY 3,080.00 |
|
LY418077 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant A |
CNY 3,080.00 |
|
LY422877 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant C |
CNY 3,080.00 |
|
TP302175 | Recombinant protein of human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A, 20 µg |
CNY 2,900.00 |
其它Membrin产品