IL6 (NM_000600) Human Mass Spec Standard
CAT#: PH302078
IL6 MS Standard C13 and N15-labeled recombinant protein (NP_000591)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | IL6 MS Standard C13 and N15-labeled recombinant protein (NP_000591) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202078 |
Predicted MW | 23.7 kDa |
Protein Sequence |
>RC202078 protein sequence
Red=Cloning site Green=Tags(s) MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKE TCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQA RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR QM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000591 |
RefSeq Size | 1201 |
RefSeq ORF | 636 |
Synonyms | BSF-2; BSF2; CDF; HGF; HSF; IFN-beta-2; IFNB2; IL-6 |
Locus ID | 3569 |
Cytogenetics | 7p15.3 |
Summary | This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2). [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Graft-versus-host disease, Hematopoietic cell lineage, Hypertrophic cardiomyopathy (HCM), Jak-STAT signaling pathway, NOD-like receptor signaling pathway, Pathways in cancer, Prion diseases, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424617 | IL6 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424617 | Transient overexpression lysate of interleukin 6 (interferon, beta 2) (IL6) |
CN¥ 3,080.00 |
|
TP302078 | Recombinant protein of human interleukin 6 (interferon, beta 2) (IL6), 20 µg |
CN¥ 2,900.00 |
|
TP701114 | Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6), Val30-End, tag free, secretory expressed in HEK293 cells, 50ug |
CN¥ 7,110.00 |
|
TP720008 | Recombinant protein of human interleukin 6 (interferon, beta 2) (IL6), the mature form (Pro29-Met212) with C-terminal His tag |
CN¥ 3,140.00 |
|
TP723713 | Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6) |
CN¥ 4,090.00 |
|
TP723955 | Human IL6 Protein, mFc-His Tag |
CN¥ 5,876.00 |
|
TP750006 | Recombinant protein of human Interleukin 6(IL-6) produced in E. coli. |
CN¥ 2,040.00 |