Protein S (PROS1) (NM_000313) Human Mass Spec Standard
CAT#: PH302073
PROS1 MS Standard C13 and N15-labeled recombinant protein (NP_000304)
View other "Protein S" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Cited in 7 publications. |
Specifications
Product Data | |
Description | PROS1 MS Standard C13 and N15-labeled recombinant protein (NP_000304) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202073 |
Predicted MW | 75.1 kDa |
Protein Sequence |
>RC202073 protein sequence
Red=Cloning site Green=Tags(s) MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIEELCNKEEARE VFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPCNEDGYMSCKDGKAS FTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKKDCKDVDECSLKPS ICGTAVCKNIPGDFECECPEGYRYNLKSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQK SCEVVSVCLPLNLDTKYELLYLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWL LIALRGGKIEVQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVEKGSYYPGSGI AQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEKSQDILLSVENTVIY RIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDLQRQLAVLDKAMKAKVATYLGGLPDVPFSAT PVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSCPSVWKKTKNS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000304 |
RefSeq Size | 3595 |
RefSeq ORF | 2028 |
Synonyms | PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6 |
Locus ID | 5627 |
Cytogenetics | 3q11.1 |
Summary | This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in this gene result in autosomal dominant hereditary thrombophilia. An inactive pseudogene of this locus is located at an adjacent region on chromosome 3. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Complement and coagulation cascades |
Citations (7)
The use of this Proteins has been cited in the following citations: |
---|
SNAP-25 is a promising novel cerebrospinal fluid biomarker for synapse degeneration in Alzheimer’s disease
,null,
Molecular Neurodegeneration
,PubMed ID 25418885
[PROS1]
|
Targeting Synaptic Pathology with a Novel Affinity Mass Spectrometry Approach *
,null,
Molecular & Cellular Proteomics : MCP
,PubMed ID 24973420
[PROS1]
|
Quantitative Liver-Specific Protein Fingerprint in Blood: A Signature for Hepatotoxicity
,null,
Theranostics
,PubMed ID 24465277
[PROS1]
|
Hypocretin (Orexin) Regulates Glutamate Input to Fast-Spiking Interneurons in Layer V of the Fr2 Region of the Murine Prefrontal Cortex
,null,
Cerebral Cortex (New York, NY)
,PubMed ID 24297328
[PROS1]
|
Autoantibody biomarkers identified by proteomics methods distinguish ovarian cancer from non ovarian cancer with various CA-125 levels
,null,
Journal of cancer research and clinical oncology
,PubMed ID 23999876
[PROS1]
|
Antibody-based Protein Profiling of the Human Chromosome 21 *
,null,
Molecular & Cellular Proteomics : MCP
,PubMed ID 22042635
[PROS1]
|
Modulation of Plasmid DNA Vaccine Antigen Clearance by Caspase 12 RNA Interference Potentiates Vaccination ▿
,null,
Clinical and Vaccine Immunology : CVI
,PubMed ID 21325489
[PROS1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400118 | PROS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400118 | Transient overexpression lysate of protein S (alpha) (PROS1) |
CN¥ 3,080.00 |
|
TP302073 | Recombinant protein of human protein S (alpha) (PROS1), 20 µg |
CN¥ 2,900.00 |
其它Protein S产品