Noxa (PMAIP1) (NM_021127) Human Mass Spec Standard
CAT#: PH302071
PMAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_066950)
View other "Noxa" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | PMAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_066950) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202071 |
Predicted MW | 5.8 kDa |
Protein Sequence |
>RC202071 representing NM_021127
Red=Cloning site Green=Tags(s) MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066950 |
RefSeq Size | 1885 |
RefSeq ORF | 162 |
Synonyms | APR; NOXA |
Locus ID | 5366 |
Cytogenetics | 18q21.32 |
Summary | This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402842 | PMAIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402842 | Transient overexpression lysate of phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) |
CN¥ 3,080.00 |
|
TP302071 | Recombinant protein of human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), 20 µg |
CN¥ 2,900.00 |