RAIDD (CRADD) (NM_003805) Human Mass Spec Standard
CAT#: PH302050
CRADD MS Standard C13 and N15-labeled recombinant protein (NP_003796)
View other "RAIDD" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CRADD MS Standard C13 and N15-labeled recombinant protein (NP_003796) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202050 |
Predicted MW | 22.7 kDa |
Protein Sequence |
>RC202050 protein sequence
Red=Cloning site Green=Tags(s) MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFD TFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGL SQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003796 |
RefSeq Size | 1201 |
RefSeq ORF | 597 |
Synonyms | MRT34; RAIDD |
Locus ID | 8738 |
Cytogenetics | 12q22 |
Summary | This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apoptosis. A mutation in this gene was associated with cognitive disability. A related pseudogene is found on chromosome 3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401252 | CRADD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401252 | Transient overexpression lysate of CASP2 and RIPK1 domain containing adaptor with death domain (CRADD) |
CNY 3,080.00 |
|
TP302050 | Recombinant protein of human CASP2 and RIPK1 domain containing adaptor with death domain (CRADD), 20 µg |
CNY 2,900.00 |
|
TP720921 | Purified recombinant protein of Human CASP2 and RIPK1 domain containing adaptor with death domain (CRADD) |
CNY 3,140.00 |