United States
Germany
Japan
United Kingdom
China
EDF1 (NM_003792) Human Mass Spec Standard
CAT＃: PH301996
EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_003783)
View other "EDF1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_003783) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201996 |
| Predicted MW | 16.4 kDa |
| Protein Sequence |
>RC201996 protein sequence
Red=Cloning site Green=Tags(s) MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP IEKGPRAK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003783 |
| RefSeq Size | 701 |
| RefSeq ORF | 444 |
| Synonyms | CFAP280; EDF-1; MBF1 |
| Locus ID | 8721 |
| Cytogenetics | 9q34.3 |
| Summary | This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407133 | EDF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418427 | EDF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407133 | Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant beta |
CNY 3,080.00 |
|
| LY418427 | Transient overexpression lysate of endothelial differentiation-related factor 1 (EDF1), transcript variant alpha |
CNY 3,080.00 |
|
| PH312036 | EDF1 MS Standard C13 and N15-labeled recombinant protein (NP_694880) |
CNY 14,250.00 |
|
| TP301996 | Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha, 20 µg |
CNY 2,900.00 |
|
| TP312036 | Purified recombinant protein of Homo sapiens endothelial differentiation-related factor 1 (EDF1), transcript variant beta, 20 µg |
CNY 2,900.00 |
|
| TP720515 | Recombinant protein of human endothelial differentiation-related factor 1 (EDF1), transcript variant alpha |
CNY 3,140.00 |
