ACYP2 (NM_138448) Human Mass Spec Standard
CAT#: PH301976
ACYP2 MS Standard C13 and N15-labeled recombinant protein (NP_612457)
View other "ACYP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ACYP2 MS Standard C13 and N15-labeled recombinant protein (NP_612457) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201976 |
Predicted MW | 11.1 kDa |
Protein Sequence |
>RC201976 protein sequence
Red=Cloning site Green=Tags(s) MSTAQSLKSVDYEVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVG SPSSRIDRTNFSNEKTISKLEYSNFSIRY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612457 |
RefSeq Size | 1238 |
RefSeq ORF | 297 |
Synonyms | ACYM; ACYP |
Locus ID | 98 |
Cytogenetics | 2p16.2 |
Summary | Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016] |
Protein Pathways | Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408599 | ACYP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408599 | Transient overexpression lysate of acylphosphatase 2, muscle type (ACYP2) |
CNY 3,080.00 |
|
TP301976 | Recombinant protein of human acylphosphatase 2, muscle type (ACYP2), 20 µg |
CNY 2,900.00 |