PEPD (NM_000285) Human Mass Spec Standard
CAT#: PH301970
PEPD MS Standard C13 and N15-labeled recombinant protein (NP_000276)
View other "PEPD" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PEPD MS Standard C13 and N15-labeled recombinant protein (NP_000276) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201970 |
Predicted MW | 54.5 kDa |
Protein Sequence |
>RC201970 protein sequence
Red=Cloning site Green=Tags(s) MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESF FHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQK PSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVM KAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGE YYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGS VDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFS GPK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000276 |
RefSeq Size | 2019 |
RefSeq ORF | 1479 |
Synonyms | PROLIDASE |
Locus ID | 5184 |
Cytogenetics | 19q13.11 |
Summary | This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424818 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431373 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431394 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424818 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 1 |
CNY 3,080.00 |
|
LY431373 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 3 |
CNY 3,080.00 |
|
LY431394 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 2 |
CNY 3,080.00 |
|
TP301970 | Recombinant protein of human peptidase D (PEPD), 20 µg |
CNY 2,900.00 |
|
TP721022 | Purified recombinant protein of Human peptidase D (PEPD), transcript variant 1 |
CNY 1,800.00 |