RAB35 (NM_006861) Human Mass Spec Standard
CAT#: PH301932
RAB35 MS Standard C13 and N15-labeled recombinant protein (NP_006852)
View other "RAB35" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RAB35 MS Standard C13 and N15-labeled recombinant protein (NP_006852) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201932 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC201932 protein sequence
Red=Cloning site Green=Tags(s) MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERF RTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAG QMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006852 |
RefSeq Size | 2962 |
RefSeq ORF | 603 |
Synonyms | H-ray; RAB1C; RAY |
Locus ID | 11021 |
Cytogenetics | 12q24.23 |
Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in the process of endocytosis and is an essential rate-limiting regulator of the fast recycling pathway back to the plasma membrane. During cytokinesis, required for the postfurrowing terminal steps, namely for intercellular bridge stability and abscission, possibly by controlling phosphatidylinositol 4,5-bis phosphate (PIP2) and SEPT2 localization at the intercellular bridge. May indirectly regulate neurite outgrowth. Together with TBC1D13 may be involved in regulation of insulin-induced glucose transporter SLC2A4/GLUT4 translocation to the plasma membrane in adipocytes.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416368 | RAB35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432597 | RAB35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416368 | Transient overexpression lysate of RAB35, member RAS oncogene family (RAB35), transcript variant 1 |
CNY 3,080.00 |
|
LY432597 | Transient overexpression lysate of RAB35, member RAS oncogene family (RAB35), transcript variant 2 |
CNY 3,080.00 |
|
TP301932 | Recombinant protein of human RAB35, member RAS oncogene family (RAB35), 20 µg |
CNY 2,900.00 |