ASCC1 (NM_015947) Human Mass Spec Standard
CAT#: PH301872
ASCC1 MS Standard C13 and N15-labeled recombinant protein (NP_057031)
View other "ASCC1" proteins (5)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ASCC1 MS Standard C13 and N15-labeled recombinant protein (NP_057031) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201872 |
Predicted MW | 41.2 kDa |
Protein Sequence |
>RC201872 protein sequence
Red=Cloning site Green=Tags(s) MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFRSTLRAPSLLY KHIVGKRGDTRKKIEMETKTSISIPKPGQDGEIVITGQHRNGVISARTRIDVLLDTFRRKQPFTHFLAFF LNEVEVQEGFLRFQEEVLAKCSMDHGVDSSIFQNPKKLHLTIGMLVLLSEEEIQQTCEMLQQCKEEFIND ISGGKPLEVEMAGIEYMNDDPGMVDVLYAKVHMKDGSNRLQELVDRVLERFQASGLIVKEWNSVKLHATV MNTLFRKDPNAEGRYNLYTAEGKYIFKERESFDGRNILKLFENFYFGSLKLNSIHISQRFTVDSFGNYAS CGQIDFS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057031 |
RefSeq Size | 2150 |
RefSeq ORF | 1071 |
Synonyms | ASC1p50; CGI-18; RP11-150D20.4 |
Locus ID | 51008 |
Cytogenetics | 10q22.1 |
Summary | This gene encodes a subunit of the activating signal cointegrator 1 (ASC-1) complex. The ASC-1 complex is a transcriptional coactivator that plays an important role in gene transactivation by multiple transcription factors including activating protein 1 (AP-1), nuclear factor kappa-B (NF-kB) and serum response factor (SRF). The encoded protein contains an N-terminal KH-type RNA-binding motif which is required for AP-1 transactivation by the ASC-1 complex. Mutations in this gene are associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414300 | ASCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC434209 | ASCC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY414300 | Transient overexpression lysate of activating signal cointegrator 1 complex subunit 1 (ASCC1) |
CN¥ 3,080.00 |
|
LY434209 | Transient overexpression lysate of activating signal cointegrator 1 complex subunit 1 (ASCC1), transcript variant 1 |
CN¥ 3,080.00 |
|
TP301872 | Recombinant protein of human activating signal cointegrator 1 complex subunit 1 (ASCC1), 20 µg |
CN¥ 2,900.00 |