UBAP1 (NM_016525) Human Mass Spec Standard
CAT#: PH301858
UBAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057609)
View other "UBAP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | UBAP1 MS Standard C13 and N15-labeled recombinant protein (NP_057609) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201858 |
Predicted MW | 55.1 kDa |
Protein Sequence |
>RC201858 protein sequence
Red=Cloning site Green=Tags(s) MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVREVQYDFSLEKKTIEWAEEIK KIEEAEREAECKIAEAEAKVNSKSGPEGDSKMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSAT KQKVLSPPHIKADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNLPRGGSGSVLQ DEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSSKVSLPPIPAVSNIKSLSFPKLDSDDSNQKT AKLASTFHSTSCLRNGTFQNSLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCT EESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVVNMGYSYECVLRAMKKKGENI EQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDN ALEDLMARAGAS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057609 |
RefSeq Size | 2743 |
RefSeq ORF | 1506 |
Synonyms | NAG20; SPG80; UAP; UBAP; UBAP-1 |
Locus ID | 51271 |
Cytogenetics | 9p13.3 |
Summary | This gene is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studies as a putative target for mutation in nasopharyngeal carcinomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402559 | UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC433186 | UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC433285 | UBAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402559 | Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY433186 | Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 2 |
CN¥ 3,080.00 |
|
LY433285 | Transient overexpression lysate of ubiquitin associated protein 1 (UBAP1), transcript variant 4 |
CN¥ 3,080.00 |
|
TP301858 | Recombinant protein of human ubiquitin associated protein 1 (UBAP1), 20 µg |
CN¥ 2,900.00 |