RHOD (NM_014578) Human Mass Spec Standard
CAT#: PH301722
RHOD MS Standard C13 and N15-labeled recombinant protein (NP_055393)
View other "RHOD" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | RHOD MS Standard C13 and N15-labeled recombinant protein (NP_055393) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201722 |
Predicted MW | 23.5 kDa |
Protein Sequence |
>RC201722 protein sequence
Red=Cloning site Green=Tags(s) MTAAQAAGEEAPPGVRSVKVVLVGDGGCGKTSLLMVFADGAFPESYTPTVFERYMVNLQVKGKPVHLHIW DTAGQDDYDRLRPLFYPDASVLLLCFDVTSPNSFDNIFNRWYPEVNHFCKKVPIIVVGCKTDLRKDKSLV NKLRRNGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRGRNFWRRITQGFCVVT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055393 |
RefSeq Size | 1150 |
RefSeq ORF | 630 |
Synonyms | ARHD; Rho; RHOHP1; RHOM |
Locus ID | 29984 |
Cytogenetics | 11q13.2 |
Summary | Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415197 | RHOD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415197 | Transient overexpression lysate of ras homolog gene family, member D (RHOD) |
CNY 3,080.00 |
|
TP301722 | Recombinant protein of human ras homolog gene family, member D (RHOD), 20 µg |
CNY 2,900.00 |