BCL7B (NM_001707) Human Mass Spec Standard
CAT#: PH301696
BCL7B MS Standard C13 and N15-labeled recombinant protein (NP_001698)
View other "BCL7B" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BCL7B MS Standard C13 and N15-labeled recombinant protein (NP_001698) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201696 |
Predicted MW | 22.2 kDa |
Protein Sequence |
>RC201696 protein sequence
Red=Cloning site Green=Tags(s) MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREP NGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLG QEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001698 |
RefSeq Size | 1729 |
RefSeq ORF | 606 |
Locus ID | 9275 |
Cytogenetics | 7q11.23 |
Summary | This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. This gene is highly conserved from C. elegans to human. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419788 | BCL7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC433989 | BCL7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419788 | Transient overexpression lysate of B-cell CLL/lymphoma 7B (BCL7B) |
CNY 3,080.00 |
|
LY433989 | Transient overexpression lysate of B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2 |
CNY 3,080.00 |
|
TP301696 | Recombinant protein of human B-cell CLL/lymphoma 7B (BCL7B), 20 µg |
CNY 2,900.00 |
|
TP330990 | Purified recombinant protein of Homo sapiens B-cell CLL/lymphoma 7B (BCL7B), transcript variant 2, 20 µg |
CNY 2,900.00 |