TCTP (TPT1) (NM_003295) Human Mass Spec Standard
CAT#: PH301664
TPT1 MS Standard C13 and N15-labeled recombinant protein (NP_003286)
View other "TCTP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TPT1 MS Standard C13 and N15-labeled recombinant protein (NP_003286) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201664 |
Predicted MW | 19.6 kDa |
Protein Sequence |
>RC201664 protein sequence
Red=Cloning site Green=Tags(s) MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGV DIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENM NPDGMVALLDYREDGVTPYMIFFKDGLEMEKC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003286 |
RefSeq Size | 4649 |
RefSeq ORF | 516 |
Synonyms | HRF; p02; p23; TCTP |
Locus ID | 7178 |
Cytogenetics | 13q14.13 |
Summary | This gene encodes a protein that is a regulator of cellular growth and proliferation. Its mRNA is highly structured and contains an oligopyrimidine tract (5'-TOP) in its 5' untranslated region that functions to repress its translation under quiescent conditions. The encoded protein is involved in a variety of cellular pathways, including apoptosis, protein synthesis and cell division. It binds to and stabilizes microtubules, and removal of this protein through phosphorylation is required for progression through mitotic and meiotic cell divisions. This gene is known to play a role in carcinogenesis, and is upregulated in some cancer cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401136 | TPT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401136 | Transient overexpression lysate of tumor protein, translationally-controlled 1 (TPT1) |
CNY 3,080.00 |
|
TP301664 | Recombinant protein of human tumor protein, translationally-controlled 1 (TPT1), 20 µg |
CNY 2,900.00 |