RFC3 (NM_002915) Human Mass Spec Standard
CAT#: PH301655
RFC3 MS Standard C13 and N15-labeled recombinant protein (NP_002906)
View other "RFC3" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | RFC3 MS Standard C13 and N15-labeled recombinant protein (NP_002906) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201655 |
Predicted MW | 40.6 kDa |
Protein Sequence |
>RC201655 protein sequence
Red=Cloning site Green=Tags(s) MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIE HQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL TKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQ LAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYE LLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDG LEGMMF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002906 |
RefSeq Size | 2396 |
RefSeq ORF | 1068 |
Synonyms | RFC38 |
Locus ID | 5983 |
Cytogenetics | 13q13.2 |
Summary | The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. This gene encodes the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405704 | RFC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419018 | RFC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405704 | Transient overexpression lysate of replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 2 |
CNY 3,080.00 |
|
LY419018 | Transient overexpression lysate of replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 1 |
CNY 3,080.00 |
|
TP301655 | Recombinant protein of human replication factor C (activator 1) 3, 38kDa (RFC3), transcript variant 1, 20 µg |
CNY 2,900.00 |