United States
Germany
Japan
United Kingdom
China
ORC4L (ORC4) (NM_002552) Human Mass Spec Standard
CAT＃: PH301587
ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_002543)
View other "ORC4L" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_002543) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201587 |
| Predicted MW | 50.4 kDa |
| Protein Sequence |
>RC201587 protein sequence
Red=Cloning site Green=Tags(s) MSSRKSKSNSLIHTECLSQVQRILRERFCRQSPHSNLFGVQVQYKHLSELLKRTALHGESNSVLIIGPRG SGKTMLINHALKELMEIEEVSENVLQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLL EALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLFDISQSAQTPIAVIGLTCRLDILELLEKRVKSRF SHRQIHLMNSFGFPQYVKIFKEQLSLPAEFPDKVFAEKWNENVQYLSEDRSVQEVLQKHFNISKNLRSLH MLLMLALNRVTASHPFMTAVDLMEASQLCSMDSKANIVHGLSVLEICLIIAMKHLNDIYEEEPFNFQMVY NEFQKFVQRKAHSVYNFEKPVVMKAFEHLQQLELIKPMERTSGNSQREYQLMKLLLDNTQIMNALQKYPN CPTDVRQWATSSLSWL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002543 |
| RefSeq Size | 6594 |
| RefSeq ORF | 1308 |
| Synonyms | ORC4L; ORC4P |
| Locus ID | 5000 |
| Cytogenetics | 2q23.1 |
| Summary | The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene. [provided by RefSeq, Oct 2010] |
| Protein Pathways | Cell cycle |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405645 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC405646 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC419257 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433812 | ORC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405645 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1 |
CNY 4,840.00 |
|
| LY405646 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3 |
CNY 4,840.00 |
|
| LY419257 | Transient overexpression lysate of origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2 |
CNY 3,080.00 |
|
| LY433812 | Transient overexpression lysate of origin recognition complex, subunit 4 (ORC4), transcript variant 5 |
CNY 3,080.00 |
|
| PH311713 | ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_859526) |
CNY 19,520.00 |
|
| PH311723 | ORC4L MS Standard C13 and N15-labeled recombinant protein (NP_859525) |
CNY 19,520.00 |
|
| TP301587 | Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP311713 | Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP311723 | Recombinant protein of human origin recognition complex, subunit 4-like (yeast) (ORC4L), transcript variant 1, 20 µg |
CNY 2,900.00 |
