United States
Germany
Japan
United Kingdom
China
Argininosuccinate Lyase (ASL) (NM_001024943) Human Mass Spec Standard
CAT＃: PH301568
ASL MS Standard C13 and N15-labeled recombinant protein (NP_001020114)
View other "Argininosuccinate Lyase" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | ASL MS Standard C13 and N15-labeled recombinant protein (NP_001020114) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201568 |
| Predicted MW | 51.7 kDa |
| Protein Sequence |
>RC201568 protein sequence
Red=Cloning site Green=Tags(s) MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001020114 |
| RefSeq Size | 2061 |
| RefSeq ORF | 1392 |
| Synonyms | ASAL |
| Locus ID | 435 |
| Cytogenetics | 7q11.21 |
| Summary | This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422562 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422563 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC422564 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC424953 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY422562 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1 |
CNY 3,080.00 |
|
| LY422563 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 3 |
CNY 4,840.00 |
|
| LY422564 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 4 |
CNY 4,840.00 |
|
| LY424953 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 2 |
CNY 4,840.00 |
|
| PH317527 | ASL MS Standard C13 and N15-labeled recombinant protein (NP_000039) |
CNY 19,520.00 |
|
| TP301568 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP317527 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Argininosuccinate Lyase产品
