CSRP2 (NM_001321) Human Mass Spec Standard
CAT#: PH301565
CSRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001312)
View other "CSRP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CSRP2 MS Standard C13 and N15-labeled recombinant protein (NP_001312) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201565 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC201565 protein sequence
Red=Cloning site Green=Tags(s) MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKG YGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWH KNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001312 |
RefSeq Size | 940 |
RefSeq ORF | 579 |
Synonyms | CRP2; LMO5; SmLIM |
Locus ID | 1466 |
Cytogenetics | 12q21.2 |
Summary | CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400526 | CSRP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400526 | Transient overexpression lysate of cysteine and glycine-rich protein 2 (CSRP2) |
CNY 3,080.00 |
|
TP301565 | Recombinant protein of human cysteine and glycine-rich protein 2 (CSRP2), 20 µg |
CNY 2,900.00 |