United States
Germany
Japan
United Kingdom
China
TGIF (TGIF1) (NM_173208) Human Mass Spec Standard
CAT＃: PH301549
TGIF1 MS Standard C13 and N15-labeled recombinant protein (NP_775300)
View other "TGIF" proteins (27)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | TGIF1 MS Standard C13 and N15-labeled recombinant protein (NP_775300) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201549 |
| Predicted MW | 29.7 kDa |
| Protein Sequence |
>RC201549 protein sequence
Red=Cloning site Green=Tags(s) MKGKKGIVAASGSETEDEDSMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKAL LSQQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISETSSVESVMGIKNFMPALEETP FHSCTAGPNPTLGRPLSPKPSSPGSVLARPSVICHTTVTALKDVPFSLCQSVGVGQNTDIQQIAAKNFTD TSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLNQDFSGFQLLVDVALKRAAEMELQAKLTA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_775300 |
| RefSeq Size | 1890 |
| RefSeq ORF | 816 |
| Synonyms | HPE4; TGIF |
| Locus ID | 7050 |
| Cytogenetics | 18p11.31 |
| Summary | The protein encoded by this gene is a member of the three-amino acid loop extension (TALE) superclass of atypical homeodomains. TALE homeobox proteins are highly conserved transcription regulators. This particular homeodomain binds to a previously characterized retinoid X receptor responsive element from the cellular retinol-binding protein II promoter. In addition to its role in inhibiting 9-cis-retinoic acid-dependent RXR alpha transcription activation of the retinoic acid responsive element, the protein is an active transcriptional co-repressor of SMAD2 and may participate in the transmission of nuclear signals during development and in the adult. Mutations in this gene are associated with holoprosencephaly type 4, which is a structural anomaly of the brain. Alternative splicing has been observed at this locus and multiple splice variants encoding distinct isoforms are described. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - TGFb/BMP signaling pathway, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406652 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406653 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406654 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406655 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406656 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406799 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418813 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429136 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430396 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC430398 | TGIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406652 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 2 |
CNY 3,080.00 |
|
| LY406653 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 3 |
CNY 3,080.00 |
|
| LY406654 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 5 |
CNY 3,080.00 |
|
| LY406655 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 6 |
CNY 3,080.00 |
|
| LY406656 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 7 |
CNY 3,080.00 |
|
| LY406799 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 1 |
CNY 3,080.00 |
|
| LY418813 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 4 |
CNY 3,080.00 |
|
| LY429136 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 4 |
CNY 3,080.00 |
|
| LY430396 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 2 |
CNY 3,080.00 |
|
| LY430398 | Transient overexpression lysate of TGFB-induced factor homeobox 1 (TGIF1), transcript variant 7 |
CNY 3,080.00 |
|
| TP301549 | Recombinant protein of human TGFB-induced factor homeobox 1 (TGIF1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP760015 | Recombinant protein of human TGFB-induced factor homeobox 1 (TGIF1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
| TP760299 | Recombinant protein of human TGFB-induced factor homeobox 1 (TGIF1), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
| TP760446 | Purified recombinant protein of Human TGFB-induced factor homeobox 1 (TGIF1), transcript variant 6, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
| TP760754 | Purified recombinant protein of Human TGFB-induced factor homeobox 1 (TGIF1), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
|
| TP760828 | Purified recombinant protein of Human TGFB-induced factor homeobox 1 (TGIF1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
|
| TP760837 | Purified recombinant protein of Human TGFB-induced factor homeobox 1 (TGIF1), transcript variant 5, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
