United States
Germany
Japan
United Kingdom
China
TPD52L2 (NM_003288) Human Mass Spec Standard
CAT＃: PH301547
TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_003279)
View other "TPD52L2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_003279) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201547 |
| Predicted MW | 22.2 kDa |
| Protein Sequence |
>RC201547 protein sequence
Red=Cloning site Green=Tags(s) MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAK ERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKT SAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003279 |
| RefSeq Size | 2359 |
| RefSeq ORF | 618 |
| Synonyms | D54; TPD54 |
| Locus ID | 7165 |
| Cytogenetics | 20q13.33 |
| Summary | This gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene may be a marker for breast cancer and acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 12. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401134 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404541 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404543 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401134 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 5 |
CNY 3,080.00 |
|
| LY404541 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 6 |
CNY 3,080.00 |
|
| LY404543 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 2 |
CNY 3,080.00 |
|
| PH319692 | TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_955391) |
CNY 19,520.00 |
|
| TP301547 | Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP319692 | Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 6, 20 µg |
CNY 2,900.00 |
其它TPD52L2产品
