ALAD (NM_000031) Human Mass Spec Standard
CAT#: PH301545
ALAD MS Standard C13 and N15-labeled recombinant protein (NP_000022)
View other "ALAD" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | ALAD MS Standard C13 and N15-labeled recombinant protein (NP_000022) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201545 |
Predicted MW | 37.23 kDa |
Protein Sequence |
>RC201545 representing NM_000031
Red=Cloning site Green=Tags(s) MPLCPLAHAMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKRL EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACDVCLCPYTSHGH CGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFA SCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDL PLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000022 |
RefSeq Size | 3151 |
RefSeq ORF | 1017 |
Synonyms | ALADH; PBGS |
Locus ID | 210 |
Cytogenetics | 9q32 |
Summary | The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424965 | ALAD HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424965 | Transient overexpression lysate of aminolevulinate, delta-, dehydratase (ALAD) |
CN¥ 3,080.00 |
|
TP301545 | Recombinant protein of human aminolevulinate, delta-, dehydratase (ALAD), 20 µg |
CN¥ 2,900.00 |