United States
Germany
Japan
United Kingdom
China
Breast cancer suppressor candidate 1 (VWA5A) (NM_198315) Human Mass Spec Standard
CAT＃: PH301474
VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_938057)
View other "Breast cancer suppressor candidate 1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_938057) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201474 |
| Predicted MW | 45.9 kDa |
| Protein Sequence |
>RC201474 protein sequence
Red=Cloning site Green=Tags(s) MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_938057 |
| RefSeq Size | 1874 |
| RefSeq ORF | 1245 |
| Synonyms | BCSC-1; BCSC1; LOH11CR2A |
| Locus ID | 4013 |
| Cytogenetics | 11q24.2 |
| Summary | May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402354 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC405013 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427178 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY402354 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1 |
CNY 4,840.00 |
|
| LY405013 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2 |
CNY 3,080.00 |
|
| LY427178 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3 |
CNY 4,840.00 |
|
| PH312185 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_055437) |
CNY 19,520.00 |
|
| PH326168 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_001123614) |
CNY 19,520.00 |
|
| TP301474 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP312185 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326168 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP710317 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
|
| TP761749 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Breast cancer suppressor candidate 1产品
