POLR1D (NM_015972) Human Mass Spec Standard
CAT#: PH301466
POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_057056)
View other "POLR1D" proteins (7)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_057056) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201466 |
Predicted MW | 15.2 kDa |
Protein Sequence |
>RC201466 protein sequence
Red=Cloning site Green=Tags(s) MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGY TTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057056 |
RefSeq Size | 817 |
RefSeq ORF | 399 |
Synonyms | AC19; POLR1C; RPA9; RPA16; RPAC2; RPC16; RPO1-3; TCS2 |
Locus ID | 51082 |
Cytogenetics | 13q12.2 |
Summary | The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2011] |
Protein Families | Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Cytosolic DNA-sensing pathway, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407348 | POLR1D HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC414277 | POLR1D HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY407348 | Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2 |
CN¥ 3,080.00 |
|
LY414277 | Transient overexpression lysate of polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1 |
CN¥ 3,080.00 |
|
PH302300 | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_689918) |
CN¥ 19,520.00 |
|
TP301466 | Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP302300 | Recombinant protein of human polymerase (RNA) I polypeptide D, 16kDa (POLR1D), transcript variant 2, 20 µg |
CN¥ 2,900.00 |