HMGA1 (NM_002131) Human Mass Spec Standard
CAT#: PH301458
HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122)
View other "HMGA1" proteins (25)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201458 |
Predicted MW | 10.7 kDa |
Protein Sequence |
>RC201458 protein sequence
Red=Cloning site Green=Tags(s) MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGR KPRGRPKKLEKEEEEGISQESSEEEQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002122 |
RefSeq Size | 1998 |
RefSeq ORF | 288 |
Synonyms | HMG-R; HMGA1A; HMGIY |
Locus ID | 3159 |
Cytogenetics | 6p21.31 |
Summary | This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407836 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407837 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407838 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407839 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407840 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC407841 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC419517 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY407836 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1 |
CN¥ 3,080.00 |
|
LY407837 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 |
CN¥ 3,080.00 |
|
LY407838 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 |
CN¥ 3,080.00 |
|
LY407839 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 5 |
CN¥ 3,080.00 |
|
LY407840 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 6 |
CN¥ 3,080.00 |
|
LY407841 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 |
CN¥ 3,080.00 |
|
LY419517 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 2 |
CN¥ 3,080.00 |
|
PH302928 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665906) |
CN¥ 19,520.00 |
|
PH304972 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665910) |
CN¥ 19,520.00 |
|
PH313109 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665909) |
CN¥ 19,520.00 |
|
PH317302 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665911) |
CN¥ 19,520.00 |
|
PH317358 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665912) |
CN¥ 19,520.00 |
|
TP301458 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
|
TP302928 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP304972 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 5, 20 µg |
CN¥ 2,900.00 |
|
TP313109 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
TP317302 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 6, 20 µg |
CN¥ 2,900.00 |
|
TP317358 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 7, 20 µg |
CN¥ 2,900.00 |