GADD45G (NM_006705) Human Mass Spec Standard
CAT#: PH301364
GADD45G MS Standard C13 and N15-labeled recombinant protein (NP_006696)
View other "GADD45G" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | GADD45G MS Standard C13 and N15-labeled recombinant protein (NP_006696) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201364 |
Predicted MW | 17.1 kDa |
Protein Sequence |
>RC201364 protein sequence
Red=Cloning site Green=Tags(s) MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL FCEESRSVNDWVPSITLPE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006696 |
RefSeq Size | 1087 |
RefSeq ORF | 477 |
Synonyms | CR6; DDIT2; GADD45gamma; GRP17 |
Locus ID | 10912 |
Cytogenetics | 9q22.2 |
Summary | This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008] |
Protein Pathways | Cell cycle, MAPK signaling pathway, p53 signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416476 | GADD45G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416476 | Transient overexpression lysate of growth arrest and DNA-damage-inducible, gamma (GADD45G) |
CNY 3,080.00 |
|
TP301364 | Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G), 20 µg |
CNY 2,900.00 |
|
TP720527 | Recombinant protein of human growth arrest and DNA-damage-inducible, gamma (GADD45G) |
CNY 3,140.00 |
其它GADD45G产品