GTF2H1 (NM_005316) Human Mass Spec Standard
CAT#: PH301341
GTF2H1 MS Standard C13 and N15-labeled recombinant protein (NP_005307)
View other "GTF2H1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | GTF2H1 MS Standard C13 and N15-labeled recombinant protein (NP_005307) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201341 |
Predicted MW | 62 kDa |
Protein Sequence |
>RC201341 protein sequence
Red=Cloning site Green=Tags(s) MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLH AGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAE EFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAEN VPHNMTEKEFWTRFFQSHYFHRDRLNTGSKDLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEG YGISSVPSASNSKSIKENSNAAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVK RAKLQESIEYEDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKV VKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKKT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005307 |
RefSeq Size | 3308 |
RefSeq ORF | 1644 |
Synonyms | BTF2; P62; TFB1; TFIIH |
Locus ID | 2965 |
Cytogenetics | 11p15.1 |
Summary | Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Basal transcription factors, Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417388 | GTF2H1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428028 | GTF2H1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417388 | Transient overexpression lysate of general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1 |
CNY 3,080.00 |
|
LY428028 | Transient overexpression lysate of general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2 |
CNY 3,080.00 |
|
TP301341 | Recombinant protein of human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 20 µg |
CNY 2,900.00 |