ATP6V1E1 (NM_001696) Human Mass Spec Standard
CAT#: PH301267
ATP6V1E1 MS Standard C13 and N15-labeled recombinant protein (NP_001687)
View other "ATP6V1E1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ATP6V1E1 MS Standard C13 and N15-labeled recombinant protein (NP_001687) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201267 |
Predicted MW | 26.1 kDa |
Protein Sequence |
>RC201267 protein sequence
Red=Cloning site Green=Tags(s) MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKI QMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQD FPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPE VRGALFGANANRKFLD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001687 |
RefSeq Size | 1406 |
RefSeq ORF | 678 |
Synonyms | ARCL2C; ATP6E; ATP6E2; ATP6V1E; P31; Vma4 |
Locus ID | 529 |
Cytogenetics | 22q11.21 |
Summary | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq, Jul 2008] |
Protein Pathways | Epithelial cell signaling in Helicobacter pylori infection, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419796 | ATP6V1E1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422039 | ATP6V1E1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419796 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (ATP6V1E1), transcript variant 1 |
CNY 3,080.00 |
|
LY422039 | Transient overexpression lysate of ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (ATP6V1E1), transcript variant 3 |
CNY 3,080.00 |
|
TP301267 | Recombinant protein of human ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (ATP6V1E1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它ATP6V1E1产品