POLR2E (NM_002695) Human Mass Spec Standard
CAT#: PH301266
POLR2E MS Standard C13 and N15-labeled recombinant protein (NP_002686)
View other "POLR2E" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | POLR2E MS Standard C13 and N15-labeled recombinant protein (NP_002686) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201266 |
Predicted MW | 24.6 kDa |
Protein Sequence |
>RC201266 protein sequence
Red=Cloning site Green=Tags(s) MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTD QMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINIT EHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002686 |
RefSeq Size | 2866 |
RefSeq ORF | 630 |
Synonyms | hRPB25; hsRPB5; RPABC1; RPB5; XAP4 |
Locus ID | 5434 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2015] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419161 | POLR2E HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419161 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E) |
CNY 3,080.00 |
|
TP301266 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide E, 25kDa (POLR2E), 20 µg |
CNY 2,900.00 |