NCF1 (NM_000265) Human Mass Spec Standard
CAT#: PH301233
NCF1 MS Standard C13 and N15-labeled recombinant protein (NP_000256)
View other "NCF1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | NCF1 MS Standard C13 and N15-labeled recombinant protein (NP_000256) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201233 |
Predicted MW | 44.5 kDa |
Protein Sequence |
>RC201233 representing NM_000265
Red=Cloning site Green=Tags(s) MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENR IIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYL MPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFL EPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYL QKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPL EEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASPV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000256 |
RefSeq Size | 1409 |
RefSeq ORF | 1170 |
Synonyms | CGD1; NCF1A; NOXO2; p47phox; SH3PXD1A |
Locus ID | 653361 |
Cytogenetics | 7q11.23 |
Summary | The protein encoded by this gene is a 47 kDa cytosolic subunit of neutrophil NADPH oxidase. This oxidase is a multicomponent enzyme that is activated to produce superoxide anion. Mutations in this gene have been associated with chronic granulomatous disease. [provided by RefSeq, Jul 2008] |
Protein Pathways | Chemokine signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
S-Glutathionylation of p47phox sustains superoxide generation in activated neutrophils.
,null,
Biochimica et biophysica acta. Molecular cell research
,PubMed ID 29195919
[NCF1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400103 | NCF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400103 | Transient overexpression lysate of neutrophil cytosolic factor 1 (NCF1) |
CNY 3,080.00 |
|
TP301233 | Recombinant protein of human neutrophil cytosolic factor 1 (NCF1), 20 µg |
CNY 2,900.00 |
|
TP761217 | Purified recombinant protein of Human neutrophil cytosolic factor 1 (NCF1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |