TRIB2 (NM_021643) Human Mass Spec Standard
CAT#: PH301210
TRIB2 MS Standard C13 and N15-labeled recombinant protein (NP_067675)
View other "TRIB2" proteins (3)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | TRIB2 MS Standard C13 and N15-labeled recombinant protein (NP_067675) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201210 |
Predicted MW | 38.8 kDa |
Protein Sequence |
>RC201210 protein sequence
Red=Cloning site Green=Tags(s) MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPL EGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSF VRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLS DKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPK AKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_067675 |
RefSeq Size | 4408 |
RefSeq ORF | 1029 |
Synonyms | C5FW; GS3955; TRB2 |
Locus ID | 28951 |
Cytogenetics | 2p24.3 |
Summary | This gene encodes one of three members of the Tribbles family. The Tribbles members share a Trb domain, which is homologous to protein serine-threonine kinases, but lacks the active site lysine and probably lacks a catalytic function. The Tribbles proteins interact and modulate the activity of signal transduction pathways in a number of physiological and pathological processes. This Tribbles member induces apoptosis of cells mainly of the hematopoietic origin. It has been identified as a protein up-regulated by inflammatory stimuli in myeloid (THP-1) cells, and also as an oncogene that inactivates the transcription factor C/EBPalpha (CCAAT/enhancer-binding protein alpha) and causes acute myelogenous leukemia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402872 | TRIB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402872 | Transient overexpression lysate of tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1 |
CN¥ 3,080.00 |
|
TP301210 | Recombinant protein of human tribbles homolog 2 (Drosophila) (TRIB2), transcript variant 1, 20 µg |
CN¥ 2,900.00 |