GET3 (NM_004317) Human Mass Spec Standard
CAT#: PH301194
ASNA1 MS Standard C13 and N15-labeled recombinant protein (NP_004308)
View other "GET3" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ASNA1 MS Standard C13 and N15-labeled recombinant protein (NP_004308) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201194 |
Predicted MW | 38.8 kDa |
Protein Sequence |
>RC201194 protein sequence
Red=Cloning site Green=Tags(s) MAAGVAGWGVEAEEFEDAPDVEPLEPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLI ISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPSLGVAELPDEFFEEDNMLSMGKKMMQEAMSAFP GIDEAMSYAEVMRLVKGMNFSVVVFDTAPTGHTLRLLNFPTIVERGLGRLMQIKNQISPFISQMCNMLGL GDMNADQLASKLEETLPVIRSVSEQFKDPEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIVNQL VFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004308 |
RefSeq Size | 1298 |
RefSeq ORF | 1044 |
Synonyms | ARSA-I; ARSA1; ASNA-I; ASNA1; TRC40 |
Locus ID | 439 |
Cytogenetics | 19p13.13 |
Summary | This gene represents the human homolog of the bacterial arsA gene, encoding the arsenite-stimulated ATPase component of the arsenite transporter responsible for resistance to arsenicals. This protein is also a central component of a transmembrane domain (TMD) recognition complex (TRC) that is involved in the post-translational delivery of tail-anchored (TA) proteins from the cytosol to the endoplasmic reticulum (ER). It recognizes and selectively binds the TMD of TA proteins in the cytosol, and delivers them to the ER for insertion. [provided by RefSeq, Oct 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418062 | ASNA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418062 | Transient overexpression lysate of arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1) |
CNY 3,080.00 |
|
TP301194 | Recombinant protein of human arsA arsenite transporter, ATP-binding, homolog 1 (bacterial) (ASNA1), 20 µg |
CNY 2,900.00 |