IDH2 (NM_002168) Human Mass Spec Standard
CAT#: PH301152
IDH2 MS Standard C13 and N15-labeled recombinant protein (NP_002159)
View other "IDH2" proteins (13)
Need it in bulk or customized? Get a free quote |
CN¥ 19,520.00
Specifications
Product Data | |
Description | IDH2 MS Standard C13 and N15-labeled recombinant protein (NP_002159) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201152 |
Predicted MW | 50.9 kDa |
Protein Sequence |
>RC201152 protein sequence
Red=Cloning site Green=Tags(s) MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002159 |
RefSeq Size | 1818 |
RefSeq ORF | 1356 |
Synonyms | D2HGA2; ICD-M; IDH; IDHM; IDP; IDPM; mNADP-IDH |
Locus ID | 3418 |
Cytogenetics | 15q26.1 |
Summary | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014] |
Protein Pathways | Citrate cycle (TCA cycle), Glutathione metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400787 | IDH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY400787 | Transient overexpression lysate of isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein |
CN¥ 3,080.00 |
|
TP301152 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, 20 µg |
CN¥ 2,900.00 |
|
TP700057 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172K), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CN¥ 6,650.00 |
|
TP700058 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172M), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CN¥ 6,650.00 |
|
TP700059 | Recombinant protein of human isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2 mutant R172G), nuclear gene encoding mitochondrial protein, with C-terminal MYC/DDK tag, expressed in human cells, 20ug |
CN¥ 6,650.00 |
|
TP710214 | Purified recombinant protein of mutant(R172G) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg |
CN¥ 4,020.00 |
|
TP710215 | Purified recombinant protein of mutant(R172M) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg |
CN¥ 4,020.00 |
|
TP710216 | Purified recombinant protein of mutant(R172K) of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2),with C-terminal DDK tag,expressed in sf9 cells, 20 µg |
CN¥ 4,020.00 |
|
TP710217 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2), nuclear gene encoding mitochondrial protein, full length, with C-terminal HIS tag, expressed in sf9, 20ug |
CN¥ 4,020.00 |
|
TP710228 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172G) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg |
CN¥ 4,020.00 |
|
TP710229 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172M) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg |
CN¥ 4,020.00 |
|
TP710230 | Purified recombinant protein of Homo sapiens isocitrate dehydrogenase 2 (NADP+), mitochondrial (IDH2) and mutant(R172K) heterodimer, with C-terminal 6xHis and DDK tags, expressed in sf9 cells, 20 µg |
CN¥ 4,020.00 |