ASCL1 (NM_004316) Human Mass Spec Standard
CAT#: PH301123
ASCL1 MS Standard C13 and N15-labeled recombinant protein (NP_004307)
View other "ASCL1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | ASCL1 MS Standard C13 and N15-labeled recombinant protein (NP_004307) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201123 |
Predicted MW | 25.5 kDa |
Protein Sequence |
>RC201123 protein sequence
Red=Cloning site Green=Tags(s) MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAA DGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFAT LREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVS SYSSDEGSYDPLSPEEQELLDFTNWF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004307 |
RefSeq Size | 2490 |
RefSeq ORF | 708 |
Synonyms | ASH1; bHLHa46; HASH1; MASH1 |
Locus ID | 429 |
Cytogenetics | 12q23.2 |
Summary | This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401374 | ASCL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401374 | Transient overexpression lysate of achaete-scute complex homolog 1 (Drosophila) (ASCL1) |
CNY 3,080.00 |
|
TP301123 | Recombinant protein of human achaete-scute complex homolog 1 (Drosophila) (ASCL1), 20 µg |
CNY 2,900.00 |