DAP1 (DAP) (NM_004394) Human Mass Spec Standard
CAT#: PH301120
DAP MS Standard C13 and N15-labeled recombinant protein (NP_004385)
View other "DAP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | DAP MS Standard C13 and N15-labeled recombinant protein (NP_004385) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201120 |
Predicted MW | 11.2 kDa |
Protein Sequence |
>RC201120 protein sequence
Red=Cloning site Green=Tags(s) MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDF PPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004385 |
RefSeq Size | 2385 |
RefSeq ORF | 306 |
Locus ID | 1611 |
Cytogenetics | 5p15.2 |
Summary | This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418020 | DAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418020 | Transient overexpression lysate of death-associated protein (DAP) |
CNY 3,080.00 |
|
TP301120 | Recombinant protein of human death-associated protein (DAP), 20 µg |
CNY 2,900.00 |