POLR2D (NM_004805) Human Mass Spec Standard
CAT#: PH301116
POLR2D MS Standard C13 and N15-labeled recombinant protein (NP_004796)
View other "POLR2D" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | POLR2D MS Standard C13 and N15-labeled recombinant protein (NP_004796) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201116 |
Predicted MW | 16.3 kDa |
Protein Sequence |
>RC201116 protein sequence
Red=Cloning site Green=Tags(s) MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTAR FSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSF QY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004796 |
RefSeq Size | 2338 |
RefSeq ORF | 426 |
Synonyms | HSRBP4; HSRPB4; RBP4; RPB4; RPB16 |
Locus ID | 5433 |
Cytogenetics | 2q14.3 |
Summary | This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417740 | POLR2D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417740 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide D (POLR2D) |
CNY 3,080.00 |
|
TP301116 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide D (POLR2D), 20 µg |
CNY 2,900.00 |