United States
Germany
Japan
United Kingdom
China
FAM3C (NM_014888) Human Mass Spec Standard
CAT＃: PH301036
FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_055703)
View other "FAM3C" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_055703) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201036 |
| Predicted MW | 24.7 kDa |
| Protein Sequence |
>RC201036 protein sequence
Red=Cloning site Green=Tags(s) MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFA FKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQ DGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYE GWPEVVEMEGCIPQKQD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055703 |
| RefSeq Size | 2552 |
| RefSeq ORF | 681 |
| Synonyms | GS3786; ILEI |
| Locus ID | 10447 |
| Cytogenetics | 7q31.31 |
| Summary | This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414959 | FAM3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421876 | FAM3C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414959 | Transient overexpression lysate of family with sequence similarity 3, member C (FAM3C), transcript variant 1 |
CNY 3,080.00 |
|
| LY421876 | Transient overexpression lysate of family with sequence similarity 3, member C (FAM3C), transcript variant 2 |
CNY 3,080.00 |
|
| PH318912 | FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_001035109) |
CNY 19,520.00 |
|
| TP301036 | Recombinant protein of human family with sequence similarity 3, member C (FAM3C), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP318912 | Recombinant protein of human family with sequence similarity 3, member C (FAM3C), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720641 | Purified recombinant protein of Human family with sequence similarity 3, member C (FAM3C), transcript variant 1 |
CNY 3,140.00 |
