Cytochrome C Oxidase subunit VIb (COX6B1) (NM_001863) Human Mass Spec Standard
CAT#: PH300957
COX6B1 MS Standard C13 and N15-labeled recombinant protein (NP_001854)
View other "Cytochrome C Oxidase subunit VIb" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | COX6B1 MS Standard C13 and N15-labeled recombinant protein (NP_001854) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200957 |
Predicted MW | 10.2 kDa |
Protein Sequence |
>RC200957 protein sequence
Red=Cloning site Green=Tags(s) MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWV TDWDEQRAEGTFPGKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001854 |
RefSeq Size | 590 |
RefSeq ORF | 258 |
Synonyms | COX6B; COXG; COXVIb1; MC4DN7 |
Locus ID | 1340 |
Cytogenetics | 19q13.12 |
Summary | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq, Jan 2010] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419691 | COX6B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419691 | Transient overexpression lysate of cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) (COX6B1), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
TP300957 | Recombinant protein of human cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) (COX6B1), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2,900.00 |
其它Cytochrome C Oxidase subunit VIb产品